PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 438aa    MW: 49667.4 Da    PI: 5.423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142670348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd +l d ++++G+++W+ Ia+++   ++  qc+ rw++yl
   XP_013587083.1 26 TWTPEEDVILRDQITLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 70
                     6****************************9.*************97 PP

2Myb_DNA-binding431e-1376119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
   XP_013587083.1  76 RGGWSPEEDILLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 119
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5441970IPR017930Myb domain
SuperFamilySSF466894.03E-2523117IPR009057Homeodomain-like
SMARTSM007171.8E-122372IPR001005SANT/Myb domain
CDDcd001673.25E-122670No hitNo description
PfamPF139212.1E-152787No hitNo description
Gene3DG3DSA:1.10.10.602.0E-192778IPR009057Homeodomain-like
PROSITE profilePS5129420.43471125IPR017930Myb domain
SMARTSM007173.4E-1475123IPR001005SANT/Myb domain
CDDcd001672.18E-1079120No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1879124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MEDTKKKKKK NINNEDSKKK ERHIVTWTPE EDVILRDQIT LHGTENWAII ASKFKDKSTR  60
QCRRRWYTYL NSDFKRGGWS PEEDILLCEA QRVFGNRWTE IAKVVSGRTD NAVKNRFTTL  120
CKKRAKHEAM ANSNNKRMLF LDGISTPQKA DNEAPIAKRT RRSHILELTE MNNYGNVEPC  180
LNQQARSPFS VLAHNATGID SLEEQYQTSN VKESDGEGMF LKKDDPKVTA LMQQAELLSS  240
LAQKVNADNT EQSMENAWKV LQDFLNKGKE NDLLRYGFPD IDFQLEEFRD LIGDLRSSYE  300
DNDPSWRQPD LHDSPASSEN SSGSTIMLDQ SGDKTQPSLP DPPQTEHKES GEEFPSTCDV  360
LKNPDENKPI SGDEENFSSP IQVTPLFRSL ADGIPSPQFS ESERSFLLKT LGIESSSPCP  420
SANPSQPPPC KRVLLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-252712510108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756660.0KM975666.1 Brassica napus MYB transcription factor 124.1 (MYB124.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587083.10.0PREDICTED: myb-related protein B
TrEMBLA0A0D3CA360.0A0A0D3CA36_BRAOL; Uncharacterized protein
STRINGBra019658.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.20.0MYB family protein